PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_175772g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 383aa    MW: 43347.8 Da    PI: 6.8415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_175772g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.5e-1459106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+ Ed +l d+++ +G   W+  +r+ g++R++k+c++rw +yl
   MA_175772g0010  59 RGAWTKVEDMILSDYIRSHGDSEWRNLPRKAGLKRCGKSCRLRWKNYL 106
                      89********************************************97 PP

2Myb_DNA-binding47.15.4e-15112155146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l+ +++++lG++ W++Ia +++ gRt++++k++w++
   MA_175772g0010 112 RGNISQDEEDLIFRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 155
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2050109IPR009057Homeodomain-like
PROSITE profilePS5129413.5254106IPR017930Myb domain
SuperFamilySSF466891.48E-2556153IPR009057Homeodomain-like
SMARTSM007175.7E-1158108IPR001005SANT/Myb domain
PfamPF002491.1E-1159106IPR001005SANT/Myb domain
CDDcd001672.06E-861106No hitNo description
PROSITE profilePS5129424.873107161IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-23110161IPR009057Homeodomain-like
SMARTSM007178.4E-15111159IPR001005SANT/Myb domain
PfamPF002492.2E-13112155IPR001005SANT/Myb domain
CDDcd001671.04E-10116157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MAITTVFTGE NLIVVSIYTR RPIERTSDKA RGDRQLWNYR RRRSTMGRSP CCSKQGLNRG  60
AWTKVEDMIL SDYIRSHGDS EWRNLPRKAG LKRCGKSCRL RWKNYLRPDI KRGNISQDEE  120
DLIFRLHRLL GNRWSLIAGR LPGRTDNEIK NYWNTRLSKK LLSMDDSQPN FTTQDLKSSS  180
LQSHVLKTSP IKTVAVRFPE MVIPNPNNGY GRSNCSSSEA FKLCNGKEGT NSSKSWSDLL  240
LKESSTHDDF DCTAFAMADI GILETEVENS ACSIWSLADE KPPHSHYFAR DAATLAESLS  300
NLNDLSSPDC NLLTSPSDCL TYFGLEEFYN DPAALPAGAN EFECIPSDQS YMQSINIFTV  360
ADDQIIDEPI TDHMQIGFMN LIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26571615108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1028050.0BT102805.1 Picea glauca clone GQ02016_I19 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279900.11e-69PREDICTED: transcription factor TT2-like
TrEMBLA9NSF01e-125A9NSF0_PICSI; Putative uncharacterized protein
STRINGVIT_04s0008g01820.t014e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-64myb domain protein 3